Comparison

CD44 Rabbit mAb European Partner

Item no. A24605-200uL
Manufacturer Abclonal
Amount 200 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, FC, IF, ICC, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNI
NCBI Cd44
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Ly-24,Pgp-1,HERMES,CD44
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
86kDa
Background
Enables hyaluronic acid binding activity and type II transforming growth factor beta receptor binding activity. Contributes to cytokine binding activity and cytokine receptor activity. Involved in several processes, including negative regulation of T cell activation; positive regulation of protein phosphorylation; and regulation of intracellular signal transduction. Acts upstream of or within several processes, including Wnt signaling pathway; morphogenesis of a branching epithelium; and wound healing involved in inflammatory response. Located in basolateral plasma membrane; external side of plasma membrane; and microvillus. Part of macrophage migration inhibitory factor receptor complex. Is expressed in several structures, including alimentary system; branchial arch; central nervous system; genitourinary system; and limb. Human ortholog(s) of this gene implicated in breast carcinoma (multiple); carcinoma (multiple); and prostate cancer. Orthologous to human CD44 (CD44 molecule (Indian blood group)).
Manufacturer - Cross Reactivity
Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 23-176 of mouse CD44 (NP_033981.2).
Recommended Dilution
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200|FC, 1:500-1:1000
Protein Size
86kDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology, Cell Type Markers, CD, AdhesionStem , Cells Mesenchymal , Stem Cells , Surface Molecules, Cancer , Tumor immunology, CD markers, Cancer Tumor, biomarkers , Other, Stem Cells , Hematopoietic , Progenitors, Lymphoid , T Lymphocytic Lineage, Stem Cells , Hematopoietic Progenitors, Myeloid, Dendritic Cell Lineage, Stem Cells , Hematopoietic Progenitors , Myeloid , Neutrophil Lineage, Kits/ Lysates/ Other Kits , ELISA Kits, ELISA Kits, CD markers ELISA kits.
Antigen Seq
QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNI
Manufacturer - Gene ID (Human)
960
Expected Protein Size
86kDa
Gene Symbol
Cd44

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close