Comparison

ABflo® 647 Rabbit anti-Human ILT5/CD85a mAb European Partner

Item no. A24712-500T
Manufacturer Abclonal
Amount 500 T
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Category
Type Antibody Monoclonal
Applications FC
Specific against Human (Homo sapiens)
Isotype IgG
Purity Affinity purification
Sequence GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQ
NCBI LILRB3
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias LILRB3,CD85A,HL9,ILT-5,ILT5,LILRA6,LIR-3,LIR3,PIR-B,PIRB,leukocyte immunoglobulin like receptor B3
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Manufacturer - Conjugate / Tag
ABflo® 647. Ex:656nm. Em:670nm.
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight
69kDa/71kDa
Background
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-418 of human ILT5/CD85a (NP_006855.3).
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
69kDa/71kDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology & Inflammation, CD markers, B Cell Receptor Signaling Pathway.
Antigen Seq
GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVV
Manufacturer - Gene ID (Human)
11025
Expected Protein Size
69kDa/71kDa
Gene Symbol
LILRB3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 T
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close