« Back
Home /
ABflo® 594 Rabbit anti-Mouse CD267/TACI mAb

ABflo® 594 Rabbit anti-Mouse CD267/TACI mAb

Item no.	A24920-200T
Manufacturer	Abclonal
Amount	200 T
Quantity options	100 T 100 ul 200 T 20 ul 500 T
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	FC
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Purity	Affinity purification
Sequence	FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
NCBI	Tnfrsf13b
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Taci,1200009E08Rik
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 594. Ex:594nm. Em:619nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	27kDa
Background	Acts upstream of or within B cell homeostasis; hematopoietic progenitor cell differentiation; and negative regulation of B cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in renal vasculature. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13B (TNF receptor superfamily member 13B).
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 5-129 of mouse CD267/TACI (NP_067324.1).
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	27kDa
Route	Recombinant Protein
Manufacturer - Research Area	Adaptive immune response, CDs.
Antigen Seq	FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
Manufacturer - Gene ID (Human)	23495
Expected Protein Size	27kDa
Gene Symbol	Tnfrsf13b

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24920-200T-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 T

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer