« Back
Home /
ABflo® 488 Rabbit anti-Human CD98 mAb

ABflo® 488 Rabbit anti-Human CD98 mAb

Item no.	A24932-100T
Manufacturer	Abclonal
Amount	100 T
Quantity options	100 T 100 ul 200 T 20 ul 500 T
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	FC
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	RAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTL
NCBI	SLC3A2
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	4F2,CD98,MDU1,4F2HC,4T2HC,NACAE,CD98HC
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	57kDa/61kDa/67kDa/68kDa/71kDa
Background	This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 206-630 of human CD98 (NP_002385.3).
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	57kDa/61kDa/67kDa/68kDa/71kDa
Route	Recombinant Protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding, Cancer, Signal Transduction, Endocrine Metabolism, Immunology Inflammation, CDs, Neuroscience, Calcium Signaling, Stem Cells, Hematopoietic Progenitors.
Antigen Seq	RAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA
Manufacturer - Gene ID (Human)	6520
Expected Protein Size	57kDa/61kDa/67kDa/68kDa/71kDa
Gene Symbol	SLC3A2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24932-100T-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 T

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer