« Back
Home /
ABflo® 488 Rabbit anti-Human TNFRSF10D/TRAILR4 mAb

ABflo® 488 Rabbit anti-Human TNFRSF10D/TRAILR4 mAb

Item no.	A24962-500T
Manufacturer	Abclonal
Amount	500 T
Quantity options	100 T 100 ul 200 T 20 ul 500 T
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	FC
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
NCBI	TNFRSF10D
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	DCR2,CD264,TRUNDD,TRAILR4,TRAIL-R4
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	42kDa
Background	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 56-211 of human TNFRSF10D/TRAILR4 (NP_003831.2).
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	42kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Invasion and Metastasis, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, Cytokines, NF-kB Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway.
Antigen Seq	ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Manufacturer - Gene ID (Human)	8793
Expected Protein Size	42kDa
Gene Symbol	TNFRSF10D

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24962-500T-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 T

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer