« Back
Home /
[KD Validated] TIMM10 Rabbit mAb

[KD Validated] TIMM10 Rabbit mAb

Item no.	A24996-100uL
Manufacturer	Abclonal
Amount	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
NCBI	TIMM10
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	TIM10,TIM10A,TIMM10A,[KD Validated] TIMM10
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	10kDa
Background	The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-90aa of human TIMM10 (NP_000204.3).
Recommended Dilution	WB, 1:2000 - 1:7000\|IHC-P, 1:500 - 1:1000\|IF/ICC, 1:50 - 1:200
Protein Size	10kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, Endocrine Metabolism, Mitochondrial metabolism.
Antigen Seq	MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Manufacturer - Gene ID (Human)	26519
Expected Protein Size	10kDa
Gene Symbol	TIMM10

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24996-100uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer