« Back
Home /
CXCL1 Rabbit mAb

CXCL1 Rabbit mAb

Item no.	A25014-50uL
Manufacturer	Abclonal
Amount	50 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
NCBI	CXCL1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	KC,Fsp,N51,gro,Gro1,Mgsa,Scyb1,CXCL1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	10kDa
Background	This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-96 of mouse CXCL1(NP_032202.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	10kDa
Route	Recombinant protein
Manufacturer - Research Area	Cell Biology Developmental Biology, Growth factors, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway.
Antigen Seq	APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Manufacturer - Gene ID (Human)	2919
Expected Protein Size	10kDa
Gene Symbol	CXCL1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A25014-50uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer