« Back
Home /
TIMM17B Rabbit mAb

TIMM17B Rabbit mAb

Item no.	A25016-100uL
Manufacturer	Abclonal
Amount	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	PQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGT
NCBI	TIMM17B
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	JM3,TIM17B,DXS9822,TIMM17B
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	18kDa
Background	This gene encodes a multipass transmembrane protein that forms an integral component of the mitochondrial translocase TIM23 complex. This complex facilitates the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 60-160 of human TIMM17B (NP_005825.1).
Recommended Dilution	WB, 1:1000 - 1:5000
Protein Size	18kDa
Route	Synthetic peptide
Manufacturer - Research Area	Endocrine Metabolism, Mitochondrial metabolism.
Antigen Seq	PQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGT
Manufacturer - Gene ID (Human)	10245
Expected Protein Size	18kDa
Gene Symbol	TIMM17B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A25016-100uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer