« Back
Home /
IRF2 Rabbit pAb

IRF2 Rabbit pAb

Item no.	A2558-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	KKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
NCBI	IRF2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	IRF-2,IRF2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	39kDa
Background	IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 120-349 of human IRF2 (NP_002190.2).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:100
Protein Size	39kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway.
Antigen Seq	KKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
Manufacturer - Gene ID (Human)	3660
Expected Protein Size	39kDa
Gene Symbol	IRF2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2558-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 10/9/2025

Compare

Add to wishlist

Get an offer

Request delivery time