« Back
Home /
BTG3 Rabbit pAb

BTG3 Rabbit pAb

Item no.	A2669-20uL
Manufacturer	Abclonal
Amount	20 uL
Quantity options	1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLA
NCBI	BTG3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ANA,TOB5,TOFA,APRO4,TOB55,ANA/BTG3,BTG3
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	29kDa
Background	The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human BTG3 (NP_006797.3).
Recommended Dilution	WB, 1:200 - 1:1000
Protein Size	29kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Cell Biology Developmental Biology, Cell Cycle, Cell cycle inhibitors.
Antigen Seq	DEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLA
Manufacturer - Gene ID (Human)	10950
Expected Protein Size	29kDa
Gene Symbol	BTG3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2669-20uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer