« Back
Home /
Acetyl-Histone H3-K27 Rabbit mAb

Acetyl-Histone H3-K27 Rabbit mAb

Item no.	A2771-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies CHiP Immunostaining Dot Blot Immunochemistry
Type	Antibody Monoclonal
Applications	WB, IF, IP, ICC, ELISA, IHC-P, CHIP, Dot
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
NCBI	Histone H3
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Shipping Condition	Cool pack
Available
Manufacturer - Category	Acetylated Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	15kDa
Background	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Manufacturer - Cross Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Immunogen	A synthetic acetylated peptide around K27 of human Histone H3 (P68431).
Recommended Dilution	DB, 1:500 - 1:2000\|WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IP, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200\|ChIP, 1:50 - 1:200\|CUT&Tag, 10⁵ cells /2 μg
Protein Size	15kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Epigenetic Modifications.
Antigen Seq	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Manufacturer - Gene ID (Human)	8290/8350
Expected Protein Size	15kDa
Gene Symbol	Histone H3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2771-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 11/6/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer