Comparison

Leptin Receptor Rabbit pAb European Partner

Item no. A2999-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence ENNDKKSIYYLGVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSCSHFVENNINLGTSSKKTFASYMPQFQTCSTQTHKIMENKMCDLTV
NCBI LEPR
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias OBR,OB-R,CD295,LEP-R,LEPRD,Leptin Receptor
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
132kDa
Background
The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. It is noteworthy that this gene and LEPROT gene (GeneID:54741) share the same promoter and the first 2 exons, however, encode distinct proteins (PMID:9207021).
Manufacturer - Cross Reactivity
Human, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1070-1165 of human LEPR (NP_002294.2).
Recommended Dilution
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200
Protein Size
132kDa
Route
Recombinant protein
Manufacturer - Research Area
Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Endocrine Metabolism, Lipid Metabolism, AMPK Signaling Pathway, Endocrine and metabolic diseases, Obesity, Immunology Inflammation, CDs, Cardiovascular, Lipids, Fatty Acids.
Antigen Seq
ENNDKKSIYYLGVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSCSHFVENNINLGTSSKKTFASYMPQFQTCSTQTHKIMENKMCDLTV
Manufacturer - Gene ID (Human)
3953
Expected Protein Size
132kDa
Gene Symbol
LEPR

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Delivery expected until 10/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close