« Back
Home /
[KO Validated] SMARCB1/SNF5 Rabbit mAb

[KO Validated] SMARCB1/SNF5 Rabbit mAb

Item no.	A3247-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Sarcoma Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IP, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
NCBI	SMARCB1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	RDT,CSS3,INI1,SNF5,Snr1,BAF47,INI-1,MRD15,RTPS1,Sfh1p,hSNFS,SNF5L1,SWNTS1,PPP1R144,F5
Similar products	BAF47, INI1, SNF5L1, CSS3, SNF5, RDT, Sfh1p, Snr1, hSNFS, RTPS1, MRD15, SWNTS1, PPP1R144
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	44kDa
Background	The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).
Recommended Dilution	WB, 1:1000 - 1:5000\|IHC-P, 1:50 - 1:200
Protein Size	44kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Chromatin Remodeling, Cancer, Tumor suppressors, Cell Biology Developmental Biology, Apoptosis.
Antigen Seq	LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
Manufacturer - Gene ID (Human)	6598
Expected Protein Size	44kDa
Gene Symbol	SMARCB1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A3247-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/9/2025

Compare

Add to wishlist

Get an offer

Request delivery time