« Back
Home /
TRIB3 Rabbit mAb

TRIB3 Rabbit mAb

Item no.	A3523-50uL
Manufacturer	Abclonal
Amount	50 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGG
NCBI	TRIB3
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	NIPK,SINK,TRB3,SKIP3,C20orf97,TRIB3
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	40kDa
Background	The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.
Manufacturer - Cross Reactivity	Human
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRIB3(Q96RU7)
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	40kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Signal Transduction, Kinase, Cell Biology Developmental Biology, Apoptosis, Cell Cycle, Cell differentiation, Endocrine Metabolism, Endocrine and metabolic diseases, Diabetes, Cardiovascular.
Antigen Seq	MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGG
Manufacturer - Gene ID (Human)	57761
Expected Protein Size	40kDa
Gene Symbol	TRIB3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A3523-50uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 9/11/2025

Compare

Add to wishlist

Get an offer

Request delivery time