Comparison

SGK1 Rabbit mAb European Partner

Item no. A3936-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHF
NCBI SGK1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias SGK, SGK1
Similar products SGK
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SGK1 (O00141).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
48kDa/49kDa/51kDa/60kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Signal Transduction, Kinase, Serine threonine kinases, mTOR Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Endocrine Metabolism, Insulin Receptor Signaling Pathway, Stem Cells, Embryonic Stem Cells

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close