Comparison

Cyclin H Rabbit mAb European Partner

Item no. A4076-200ul
Manufacturer Abclonal
Amount 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
NCBI CCNH
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CAK, p34, p37, CycH, Cyclin H
Similar products p34, p37, CAK, CycH
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
38kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, DNA Damage Repair, Cell Biology Developmental Biology, Cell Cycle

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close