« Back
Home /
CD3G Rabbit mAb

CD3G Rabbit mAb

Item no.	A4085-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies By Cell Type Hematology Leukemia Lymphoma Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, FC, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	GMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
NCBI	CD3G
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	T3G, IMD17, CD3GAMMA, CD3-GAMMA, CD3G
Similar products	CD3-GAMMA, T3G, IMD17
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background	The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 83-182 of human CD3G (P09693).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200\|FC, 1:50 - 1:200
Protein Size	20kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, T Cell Receptor Signaling Pathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A4085-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer