« Back
Home /
Monoamine Oxidase A (MAOA) Rabbit mAb

Monoamine Oxidase A (MAOA) Rabbit mAb

Item no.	A4105-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Cell Biology Cell Status Immunohistochemistry Western Blot ELISA Oxidative Stress Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	GRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
NCBI	MAOA
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	BRNRS,MAO-A,Monoamine Oxidase A (MAOA)
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	60kDa
Background	This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 428-527 of human Monoamine Oxidase A (MAOA) (P21397).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	60kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Neuroscience, Neurodegenerative Diseases.
Antigen Seq	GRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Manufacturer - Gene ID (Human)	4128
Expected Protein Size	60kDa
Gene Symbol	MAOA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A4105-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time