Comparison

[KO Validated] SMARCC1/BAF155 Rabbit mAb European Partner

Item no. A4275-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, IF, ICC, ELISA, CHIP
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENE
NCBI SMARCC1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias HYC5, Rsc8, SRG3, SWI3, BAF155, CRACC1, 55
Similar products BAF155, CRACC1, Rsc8, SRG3, SWI3
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human SMARCC1/BAF155 (Q92922).
Recommended Dilution
WB, 1:500 - 1:2000|IF/ICC, 1:50 - 1:200|ChIP, 1:100 - 1:500
Protein Size
123kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Chromatin Remodeling

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close