« Back
Home /
TOMM34 Rabbit pAb

TOMM34 Rabbit pAb

Item no.	A4467-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALK
NCBI	TOMM34
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TOM34,URCC3,HTOM34P,TOMM34
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	35kDa
Background	The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human TOMM34 (NP_006800.2).
Recommended Dilution	WB, 1:500 - 1:1000\|IF/ICC, 1:50 - 1:200
Protein Size	35kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, Endocrine Metabolism, Mitochondrial metabolism.
Antigen Seq	MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Manufacturer - Gene ID (Human)	10953
Expected Protein Size	35kDa
Gene Symbol	TOMM34

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A4467-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer