Comparison

[KO Validated] p38 MAPK Rabbit mAb European Partner

Item no. A4771-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence NDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHY
NCBI MAPK14
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias RK,p38,CSBP,EXIP,Mxi2,CSBP1,CSBP2,CSPB1,PRKM14,PRKM15,SAPK2A,p38ALPHA,PK
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
41kDa
Background
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human p38 MAPK (Q16539).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
41kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Protein phosphorylation, Signal Transduction, Kinase, Serine threonine kinases, ErbB-HER Signaling Pathway, ATM Signaling Pathway, Cell Biology Developmental Biology, TGF-b-Smad Signaling Pathway, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, NF-kB Signaling Pathway, Toll-like Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, TLR Signaling, Neuroscience, Neurodegenerative Diseases, Cardiovascular, Angiogenesis.
Antigen Seq
NDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHY
Manufacturer - Gene ID (Human)
1432
Expected Protein Size
41kDa
Gene Symbol
MAPK14

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close