« Back
Home /
THRA Rabbit pAb

THRA Rabbit pAb

Item no.	A5592-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies Cell Biology Cell Movement Cell Adhesion Western Blot Primary Antibodies By Organ Breast Cancer Heart & Blood Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	IEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
NCBI	THRA
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	AR7,EAR7,ERBA,CHNG6,ERBA1,NR1A1,THRA1,THRA2,c-erbA,ERB-T-1,TRalpha,THRalpha,TRalpha1,TRalpha2,c-ERBA-1,THRalpha1,THRalpha2,THRA
Similar products	THRA, AR7, THRA1, EAR7, ERB-T-1, ERBA, ERBA1, NR1A1, THRA2, c-ERBA-1, CHNG6
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	55kDa
Background	The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 138-180 of human THRA (NP_003241.2).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	55kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Nuclear hormone receptors, Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Endocrine Metabolism, Neuroscience.
Antigen Seq	IEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
Manufacturer - Gene ID (Human)	7067
Expected Protein Size	55kDa
Gene Symbol	THRA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A5592-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer