Comparison

p53 Rabbit pAb European Partner

Item no. A5804-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence PSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKD
NCBI Trp53
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TP53, BCC7, LFS1, P53, TRP53, Trp53, bbl, bfy, bhy, p44, p53, Tp53
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mice deficient for this gene are developmentally normal but are susceptible to spontaneous tumors. Evidence to date shows that this gene contains one promoter, in contrast to alternative promoters of the human gene, and transcribes a few of splice variants which encode different isoforms, although the biological validity or the full-length nature of some variants has not been determined.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 95-390 of mouse p53 (NP_035770.2).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
43kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Transcription Factors, DNA Damage & Repair, Cancer, Tumor suppressors, p53 pathway, Signal Transduction, PI3K-Akt Signaling Pathway, ErbB-HER Signaling Pathway, MAPK-JNK Signaling Pathway, MAPK-P38 Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Cell Cycle, Cell cycle inhibitors, G1/S Checkpoint, G2/M DNA Damage Checkpoint, Endocrine & Metabolism, AMPK Signaling Pathway, Warburg Effect, Neuroscience, Neurodegenerative Diseases

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close