« Back
Home /
TRMT2A/HTF9C Rabbit pAb

TRMT2A/HTF9C Rabbit pAb

Item no.	A5975-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	LASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS
NCBI	TRMT2A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HTF9C,TRMT2A/HTF9C
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	69kDa
Background	The protein encoded by this gene is of unknown function. However, it is orthologous to the mouse Trmt2a gene and contains an RNA methyltransferase domain. Expression of this gene varies during the cell cycle, with aberrant expression being a possible biomarker in certain breast cancers. Several transcript variants encoding two different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	69kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding, Cancer, Tumor biomarkers.
Antigen Seq	LASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS
Manufacturer - Gene ID (Human)	27037
Expected Protein Size	69kDa
Gene Symbol	TRMT2A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A5975-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer