« Back
Home /
GITR Ligand/TNFSF18 Rabbit pAb

GITR Ligand/TNFSF18 Rabbit pAb

Item no.	A7028-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	CSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSE
NCBI	TNFSF18
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TL6,AITRL,GITRL,TNLG2A,hGITRL,GITR Ligand/TNFSF18
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	20kDa
Background	The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 52-177 of human GITR Ligand/TNFSF18 (NP_005083.2).
Recommended Dilution	WB, 1:1000 - 1:5000
Protein Size	20kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Growth factors, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway, Cardiovascular.
Antigen Seq	CSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSE
Manufacturer - Gene ID (Human)	8995
Expected Protein Size	20kDa
Gene Symbol	TNFSF18

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A7028-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 11/20/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer