« Back
Home /
CLIC4 Rabbit pAb

CLIC4 Rabbit pAb

Item no.	A7088-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
NCBI	CLIC4
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	H1,huH1,p64H1,CLIC4L,MTCLIC,CLIC4
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	29kDa
Background	Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-253 of human CLIC4 (NP_039234.1).
Recommended Dilution	WB, 1:100 - 1:500\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:100
Protein Size	29kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Cancer, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Cell Cycle, Endocrine Metabolism, Mitochondrial metabolism, Mitochondrial markers.
Antigen Seq	MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Manufacturer - Gene ID (Human)	25932
Expected Protein Size	29kDa
Gene Symbol	CLIC4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A7088-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 10/9/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer