« Back
Home /
TMLHE Rabbit pAb

TMLHE Rabbit pAb

Item no.	A7312-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Polyclonal
Applications	IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	CQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI
NCBI	TMLHE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TMLD,TMLH,BBOX2,AUTSX6,TMLHED,XAP130,TMLHE
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	50kDa
Background	This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane. The encoded protein converts trimethyllysine into hydroxytrimethyllysine. A pseudogene of this gene is found on chromosome X. Alternate splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 167-376 of human TMLHE (NP_001171726.1).
Recommended Dilution	IF/ICC, 1:50 - 1:100
Protein Size	50kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Cancer, Signal Transduction, Endocrine Metabolism, Mitochondrial metabolism, Mitochondrial markers, Amino acid metabolism.
Antigen Seq	CQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI
Manufacturer - Gene ID (Human)	55217
Expected Protein Size	50kDa
Gene Symbol	TMLHE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A7312-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer