« Back
Home /
PKC delta Rabbit mAb

PKC delta Rabbit mAb

Item no.	A7778-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID
NCBI	PRKCD
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	MAY1,PKCD,ALPS3,CVID9,nPKC-delta,PKC delta
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	78kDa
Background	The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	78kDa
Route	Recombinant protein
Manufacturer - Research Area	Protein phosphorylation, Cancer, Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, Kinase, Serine threonine kinases, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, TGF-b-Smad Signaling Pathway, Immunology Inflammation, B Cell Receptor Signaling Pathway, Neuroscience.
Antigen Seq	PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID
Manufacturer - Gene ID (Human)	5580
Expected Protein Size	78kDa
Gene Symbol	PRKCD

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A7778-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer