Comparison

FZD4 Rabbit pAb European Partner

Item no. A8161-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence ERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGE
NCBI FZD4
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Fz4,EVR1,FEVR,Fz-4,FzE4,GPCR,hFz4,CD344,FZD4S,FZD4
Similar products FZD4, GPCR, CD344, EVR1, FEVR, FZD4S, Fz-4, FzE4, Fz4, hFz4
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
60kDa
Background
This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 42-179 of human FZD4 (NP_036325.2).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200
Protein Size
60kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Cancer, Tumor suppressors, Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, mTOR Signaling Pathway, Cell Biology Developmental Biology, Wnt ��-Catenin Signaling Pathway, ESC Pluripotency and Differentiation, Immunology Inflammation, CDs, Stem Cells.
Antigen Seq
ERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGE
Manufacturer - Gene ID (Human)
8322
Expected Protein Size
60kDa
Gene Symbol
FZD4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Delivery expected until 12/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close