« Back
Home /
Glycogen synthase 1 (GYS1) Rabbit mAb

Glycogen synthase 1 (GYS1) Rabbit mAb

Item no.	A8912-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Metabolism Cholesterol & Lipid Metabolism Antibodies Western Blot Enzymes Prostaglandin Synthases Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	RPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN
NCBI	GYS1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	GSY,GYS,Glycogen synthase 1 (GYS1)
Similar products	GSY, GYS
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	84kDa
Background	The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1, 4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	84kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Protein phosphorylation, Cancer, Signal Transduction, PI3K-Akt Signaling Pathway, Cell Biology Developmental Biology, Cytoskeleton, Actins, Endocrine Metabolism, Carbohydrate metabolism, AMPK Signaling Pathway, Insulin Receptor Signaling Pathway, Endocrine and metabolic diseases, Diabetes, Obesity, Cardiovascular, Heart, Cardiovascular diseases, Heart disease.
Antigen Seq	RPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN
Manufacturer - Gene ID (Human)	2997
Expected Protein Size	84kDa
Gene Symbol	GYS1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A8912-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer