Comparison

Carbonic Anhydrase 2 (CA2) Rabbit mAb European Partner

Item no. A9148-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence DVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
NCBI CA2
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CAC, CAII, Car2, CA-II, HEL-76, HEL-S-282, Carbonic Anhydrase 2 (CA2)
Similar products CAC, CA-II, CAII, Car2, HEL-76, HEL-S-282
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Carbonic Anhydrase 2 (CA2) (P00918).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200
Protein Size
29kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Cell Biology Developmental Biology, Cardiovascular, Blood

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close