Comparison

DNA Ligase I Rabbit mAb European Partner

Item no. A9301-500uL
Manufacturer Abclonal
Amount 500 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQVS
NCBI LIG1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias LIGI, IMD96, hLig1, DNA Ligase I
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human DNA Ligase I (P18858).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
102kDa
Route
Recombinant protein
Manufacturer - Research Area
chromatin DNA binding, metal ion binding, methyltransferase activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding, cell fate specification, fibroblast growth factor receptor signaling pathway, germ-line stem cell population maintenance, histone H3-R26 methylation, homeostasis of number of cells within a tissue, inactivation of paternal X chromosome, inner cell mass cell fate commitment, negative regulation of fibroblast growth factor receptor signaling pathway, negative regulation of transcription by RNA polymerase II, ositive regulation of flagellated sperm motility, positive regulation of stem cell population maintenance, regulation of DNA methylation

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close