« Back
Home /
GABARAPL2 Rabbit mAb

GABARAPL2 Rabbit mAb

Item no.	A9585-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Neural Lineage Markers Antibodies Western Blot ELISA Primary Antibodies Immunostaining Glial Cell Markers
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	GSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NCBI	GABARAPL2
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ATG8,GEF2,ATG8C,GEF-2,GATE16,GATE-16,FLC3A,GABARAPL2
Similar products	ATG8, ATG8C, GATE-16, GATE16, GEF2, GEF-2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	14kDa
Background	Enables ubiquitin protein ligase binding activity. Involved in negative regulation of proteasomal protein catabolic process and protein localization to endoplasmic reticulum. Located in Golgi membrane and autophagosome membrane.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 38-117 of human GABARAPL2 (P60520).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	14kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Autophagy, Endocrine Metabolism, Mitochondrial metabolism.
Antigen Seq	GSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Manufacturer - Gene ID (Human)	11345
Expected Protein Size	14kDa
Gene Symbol	GABARAPL2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A9585-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 11/13/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer