Comparison

HRP-conjugated Mouse anti GST-Tag mAb European Partner

Item no. AE027-500uL
Manufacturer Abclonal
Amount 500 uL
Quantity options 100 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB
Specific against other
Isotype IgG2b
Conjugate/Tag HRP
Purity Affinity purification
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
NCBI GST
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias GST,GST tag,GST-tag
Shipping Condition Cool pack
Available
Manufacturer - Category
Tag Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 50% glycerol, pH7.3.
Protein Weight
26kDa
Background
Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal—also known as MAPEG—proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.
Manufacturer - Cross Reactivity
Species independent
Immunogen
Recombinant protein containing a sequence corresponding to amino acids 1-218 of GST protein.
Recommended Dilution
WB, 1:2000 - 1:10000
Protein Size
26kDa
Route
Recombinant Protein
Antigen Seq
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Expected Protein Size
26kDa
Gene Symbol
GST

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close