Comparison

mCherry Rabbit pAb European Partner

Item no. AE171-50uL
Manufacturer Abclonal
Amount 50 uL
Quantity options 100 uL 200 uL 50 uL
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against other
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI mCherry
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias mCherry,mCherry tag,mCherry-tag
Available
Specificity Discosoma
Manufacturer - Category
Tag Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
Protein tags are peptide sequences genetically grafted onto a recombinant protein. Often these tags are removable by chemical agents or by enzymatic means, such as proteolysis or intein splicing. Tags are attached to proteins for various purposes.Epitope tags are short peptide sequences which are chosen because high-affinity antibodies can be reliably produced in many different species. These are usually derived from viral genes, which explain their high immunoreactivity. Epitope tags include V5-tag, Myc-tag, HA-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification.
Manufacturer - Cross Reactivity
Species independent
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-236 of mCherry tag.
Recommended Dilution
WB, 1:2000 - 1:6000
Route
Recombinant protein
Antigen Seq
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Gene Symbol
mCherry

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close