Comparison

Anti-CaV1.2a European Partner

Item no. ALO-ACC-013-25ul
Manufacturer Alomone
Amount 25 ul
Quantity options 0.2 ml 25 ul 50 ul
Category
Type Antibody Polyclonal
Format Lyophilized
Applications WB, IF, IP, IHC, IC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Formula PBS pH7.4, 1% BSA with 0.05% sodium azide
Sequence GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Room temperature
Available
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Category
Antibodies
Manufacturer - Targets
Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C.
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Manufacturer - Format
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4
Short description
A Rabbit Polyclonal Antibody to CaV1.2a (CACNA1C) Channel
Description
Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C. - A Rabbit Polyclonal Antibody to CaV1.2a (CACNA1C) Channel
Clonality
Polyclonal
Homology
Rat, guinea pig - 31/46 amino acid residues identical
Standard quality control of each lot
Western blot analysis
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Reconstitution
25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody Concentration After Reconstitution
0.8 mg/ml
Preservative
1% BSA, 0.05% NaN3
Immunogen Location
Intracellular, N-terminus
Specificity
CACNA1C
Immunogen source species
Rabbit
PH
7, 4
UNSPSC
41116161
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody
Scientific Background
All L-type calcium channels are encoded by one of the CaV1 channel genes. These channels play a major role as a Ca2+ entry pathway in skeletal, cardiac and smooth muscles as well as in neurons, endocrine cells and possibly in non-excitable cells such as hematopoetic and epithelial cells. All CaV1 channels are influenced by dihydropyridines (DHP) and are also referred to as DHP receptors.While the CaV1.1 and CaV1.4 isoforms are expressed in restricted tissues (skeletal muscle and retina, respectively), the expression of CaV1.2 is ubiquitous and CaV1.3 channels are found in the heart, brain and pancreas. Several peptidyl toxins are described that are specific L-type channel blockers, but so far no selective blocker for one of the CaV1 isoforms have been described. These include the Mamba toxins Calcicludine (#SPC-650), Calciseptine (#C-500) and FS-2 (#F-700).There are two splice variants to the CaV1.2 channel designated CaV1.2a and CaV1.2b. The expression of the CaV1.2b variant is restricted to smooth muscle while CaV1.2a is specifically expressed in cardiac muscle.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close