Comparison

Anti-CLC-3 European Partner

Item no. ALO-ACL-001-50ul
Manufacturer Alomone
Amount 50 ul
Quantity options 0.2 ml 25 ul 50 ul
Category
Type Antibody Polyclonal
Format Lyophilized
Applications WB, IF, IP, IHC, IC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Formula PBS pH7.4, 1% BSA with 0.05% sodium azide
Sequence GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Room temperature
Available
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Category
Antibodies
Manufacturer - Targets
Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Manufacturer - Format
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4
Short description
A Rabbit Polyclonal Antibody to CLC-3 (CLCN3) Channel
Description
Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3 - A Rabbit Polyclonal Antibody to CLC-3 (CLCN3) Channel
Clonality
Polyclonal
Homology
Mouse - identical; human, rabbit, guinea pig - 69/70 amino acid residues identical; Xenopus laevis - 61/70 amino acid residues identicalRat CLC-4 - 46/70 amino acid residues identical; rat CLC-5 - 49/70 amino acid residues identical
Standard quality control of each lot
Western blot analysis
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Reconstitution
25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody Concentration After Reconstitution
0.8 mg/ml
Preservative
1% BSA, 0.05% NaN3
Immunogen Location
Intracellular, near the C-terminus
Specificity
CLCN3
Immunogen source species
Rat
PH
7, 4
UNSPSC
41116161
Ko Validate
yes
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody
Scientific Background
CLC-3 is a member of the voltage-dependent Cl- channel (CLC) family that includes nine known members in mammals. CLC channels can be classified as plasma membrane channels and intracellular organelle channels. The first group includes the CLC-1, CLC-2 CLC-Ka and CLCKb channels. The second group comprises the CLC-3, CLC-4, CLC-5, CLC-6 and CLC-7.CLC channels that function in the plasma membrane are involved in the stabilization of membrane potential and in transepithelial transport. The presumed function of the intracellular CLC channels is support of the acidification of the intraorganellar compartment. In this regard, recent reports indicate that ClC-4 and ClC-5 (and by inference ClC-3) can function as Cl-/H+ antiporters.1, 2The functional unit of the CLC channels is a dimer with each subunit forming a proper pore. Although the crystal structure of bacterial CLC channels was resolved, the topology of the CLC channels is complex and has not been fully elucidated. It is generally accepted that both the N- and C- terminus domains are intracellular while the number and configuration of the transmembrane domains vary greatly between different models. 1, 2CLC-3 is widely distributed with prominent expression in tissues of neuroectoderm origin. In the brain, it is highly expressed in the hippocampus, olfactory bulb and olfactory cortex. The channel is also prominently expressed in aortic and coronary vascular smooth muscle cells, aortic endothelial cells and tracheal and alveolar epithelial cells.The physiological function of CLC-3 is not entirely clear, but it has been suggested that CLC-3 generates a shunt current of chloride for v-H+-ATPases, thereby aiding the acidification of endosomes and synaptic vesicles as well as lysosomes. Disruption of the ClC-3 gene in mice causes severe neuronal loss, leading to a complete loss of the hippocampus in adult mice. In addition, CLC-3 has been shown to have a critical role in the respiratory burst and phagocytosis of polymorphonuclear cells, a key cell type of innate host defense. 3, 4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close