Comparison

Anti-KV1.3 (KCNA3) Antibody European Partner

Item no. ALO-APC-002-25ul
Manufacturer Alomone
Amount 25 ul
Quantity options 0.2 ml 25 ul 50 ul
Category
Type Antibody
Format Lyophilized
Applications WB, IF, IP, IHC, ICC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Purity Affinity purified on immobilized antigen.
Formula Lyophilized powder Reconstituted antibody contains phosphate buffered saline (PBS), pH 74, 1% BSA, 5% sucrose, 0025% NaN3
Sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Available
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Format
Lyophilized powder Reconstituted antibody contains phosphate buffered saline (PBS), pH 74, 1% BSA, 5% sucrose, 0025% NaN3
Short description
A Rabbit Polyclonal Antibody to KV1.3 (KCNA3) Channel
Description
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of human KV1.3. Anti-KV1.3 (KCNA3) Antibody (#APC-002) can be used in western blot, immunoprecipitation, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.3 potassium channel from human, rat, and mouse samples.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Delivery expected until 10/9/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close