Comparison

Anti-KV1.1 European Partner

Item no. ALO-APC-009-50ul
Manufacturer Alomone
Amount 50 ul
Quantity options 0.2 ml 25 ul 50 ul
Category
Type Antibody Polyclonal
Format Lyophilized
Applications WB, IF, IP, IHC, IC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Formula PBS pH7.4, 1% BSA with 0.05% sodium azide
Sequence GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Room temperature
Available
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Category
Antibodies
Manufacturer - Targets
Potassium voltage-gated channel subfamily A member 1
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Manufacturer - Format
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4
Short description
A Rabbit Polyclonal Antibody to KV1.1 (KCNA1) Channel
Description
Potassium voltage-gated channel subfamily A member 1 - A Rabbit Polyclonal Antibody to KV1.1 (KCNA1) Channel
Clonality
Polyclonal
Homology
Rat - 78/80 amino acid residues identical; human - 76/80 amino acid residues identical; Xenopus Laevis - 70/80 amino acid residues identical
Standard quality control of each lot
Western blot analysis
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Reconstitution
25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody Concentration After Reconstitution
0.8 mg/ml
Preservative
1% BSA, 0.05% NaN3
Immunogen Location
Intracellular, C-terminus
Specificity
KCNA1
Immunogen source species
Mouse
PH
7, 4
UNSPSC
41116161
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody
Scientific Background
KV1.1 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.1 was the first mammalian KV channel to be cloned from mouse brain.1 Eight Shaker-related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function. The structure of KV1.1 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the retina and pancreas.2 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. Mutations in the coding of KV1.1 gene were discovered in Episodic Ataxia patients.3KV1.1 channels are sensitive to low doses of TEA (0.3 mM) and 4-AP (0.29 mM), the "classical" non-selective potassium channel blockers.Several venomous toxins from snakes, scorpions and sea anemones are potent blockers (affecting the channels in the nanomolar range) of KV1.1 channels. Among these, the most potent and selective are α-Dendrotoxin (0.4-4 nM) and δ-Dendrotoxin (0.03-1.8 nM), Dendrotoxin-K (0.03 nM), Agitoxin-2 (0.044 nM) and Hongotoxin-1 (0.031 nM).4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close