« Back
Home /
Phospho-YAP1-S127 Rabbit mAb

Phospho-YAP1-S127 Rabbit mAb

Item no.	AP1436-50uL
Manufacturer	Abclonal
Amount	50 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies Antibody
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	LPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFL
NCBI	YAP1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	YAP1,COB1,YAP,YAP2,YAP65,YKI,Yes associated protein 1,Phospho-YAP1-S127
Shipping Condition	Cool pack
Available
Manufacturer - Category	Phosphorylated Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Background	This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic phosphorylated peptide around S127 of human YAP1(NP_001123617.1).
Recommended Dilution	WB, 1:1000 - 1:5000\|IF, 1:50 - 1:200
Protein Size	36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Transcription Factors, Cancer, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology & Developmental Biology, Hippo Signaling Pathway.
Antigen Seq	RAHSSP
Manufacturer - Gene ID (Human)	10413
Expected Protein Size	36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Gene Symbol	YAP1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

AP1436-50uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 9/11/2025

Compare

Add to wishlist

Get an offer

Request delivery time