« Back
Home /
GFRA1 Antibody

GFRA1 Antibody

Item no.	OAAL00118
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Molecular Targets for Neuroscience Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Adenocarcinoma Immunohistochemistry ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	IF, ELISA
Clone	4D8
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	GDNF family receptor alpha-1;GDNF receptor alpha 1d;GDNF receptor alpha 1e;GDNFR;GDNFRA;GDNFR-alpha-1;GFRalpha-1;GFR-ALPHA-1;Glial cell line-derived neurotrophic factor receptor alpha;GPI-linked anchor protein;PI-linked cell-surface accessory protein;RET ligand 1;RET1L;RETL1;TGF-beta-related neurotrophic factor receptor 1;TRNR1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	GFRA1
Gene Fullname	GDNF family receptor alpha 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq
Nucleotide accession_num	NM_005264
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_005255
Protein name	GDNF family receptor alpha-1 isoform a preproprotein [Homo sapiens]\|Homo sapiens GDNF family receptor alpha 1 (GFRA1), transcript variant 1, mRNA
Clonality	Monoclonal
Immunogen	GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00118-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer