Comparison

Der P1 Protein

Item no. OPPA00394
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Proteins Recombinant
Format Liquid
Applications WB, ELISA
Specific against other
Purity Protein is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.<br/>
Sequence MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVN
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Peptidase 1,Major mite fecal allergen Der p 1,Allergen Der p I,Der p 1,DERP1,Der-P1,Der P1,Der P1 Protein Recombinant
Similar products Der-1
Shipping Condition Cool pack
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Shipping Temperature
Wet Ice
Gene symbol
DER-1
Protein size
Recombinant
Product format
Liquid. 60 mM NaCl, 50 mM Tris-HCl pH 8.0 and 1.2 M Urea.
Reconstitution and storage
Der-P1 although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
Description of target
DERP1 is a thiol protease, with a preference for substrates with a large hydrophobic side chain in the P2 position, or with basic residues. DERP1 is a C1 peptidase family member. DERP1 has extensive endopeptidase specificity. DERP1 is N-glycosylated. N-glycanase treatment does not completely remove carbohydrates, suggesting that the protein contains additional glycosylation sites. DERP1 causes an allergic reaction in humans. Common symptoms of mite allergy are bronchial asthma, allergic rhinitis and conjunctivitis. DERP1 binds to IgE in 80% of patients with house dust allergy. The E.Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.8kDa, pI 5.8.
Protein name
Peptidase 1
Purification
Purified by proprietary chromatographic technique.
Warning
Products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Concentration
1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close