« Back
Home /
Recombinant Human Fibroblast growth factor 2(FGF2),partial (Active)

Recombinant Human Fibroblast growth factor 2(FGF2),partial (Active)

Item no.	CSB-AP003751HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human (Homo sapiens)
Purity	Greater than 95% as determined by SDS-PAGE.
Sequence	GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLY CKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEE RGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFF FERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSK TGPGQKAILFLPMSAKS
Protein Family	Heparin-binding growth factors family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Available
Manufacturer - Category	Cytokine / Growth Factor
Manufacturer - Conjugate / Tag	Tag-Free
Molecular Weight	17.4 kDa
General Research Areas	Signal Transduction
Relevance	FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4.
Function	Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis
Subcellular Location	Secreted, Nucleus
Tissue Specificity	Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Paythway	MAPKsignalingpathway
Gene Names	FGF2
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Expression Region	132-288aa
Protein Description	Partial
Biological Activity	The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-AP003751HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer