Comparison

Recombinant Human T-lymphocyte activation antigen CD86(CD86),partial (Active)

Item no. CSB-AP005161HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Lyophilized powder
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQ DQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSW TLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNS ELSVLANFSQPEIVPISNITENVYINLTCSSIHGY PEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYD VSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFS IELEDPQPPPDHIP
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias T-Lymphocyte Activation Antigen CD86; Activation B7-2 Antigen; B70; BU63; CTLA-4 Counter-Receptor B7.2; FUN-1; CD86; CD28LG2
Available
Manufacturer - Category
Drug Target / Immune Checkpoint
Manufacturer - Conjugate / Tag
C-terminal 6xHis-tagged
Molecular Weight
26.69 kDa
General Research Areas
Immunology
Relevance
The protein is the receptor that involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. The protein interacts with MARCH8, human herpesvirus 8 MIR2 protein, adenovirus subgroup B fiber proteins and acts as a receptor for these viruses.It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.It contains 1 Ig-like C2-type(immunoglobulin-like) domainand 1 Ig-like V-type (immunoglobulin-like) domain.
Function
Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.; FUNCTION
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Expressed by activated B-lymphocytes and monocytes.
Paythway
Toll-likereceptorsignalingpathway
Gene Names
CD86
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Expression Region
24-247aa
Protein Description
Extracellular Domain
Biological Activity
The ED50 as determined by its ability to bind Human CTLA-4 in functional ELISA is less than 20 ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close