Comparison

Recombinant Human Thioredoxin(TXN) (Active)

Item no. CSB-AP005541HU-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Lyophilized powder
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPC KMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Protein Family Thioredoxin family
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1
Available
Manufacturer - Category
Other Recombinant Protein / Others
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
13.9 kDa
General Research Areas
Signal Transduction
Relevance
Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide.
Function
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION
Subcellular Location
Nucleus, Cytoplasm, Secreted
Paythway
NOD-likereceptorsignalingpathway
Gene Names
TXN
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Expression Region
1-105aa
Protein Description
Full Length
Biological Activity
Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close