« Back
Home /
Recombinant Human Rab GDP dissociation inhibitor beta(GDI2)

Recombinant Human Rab GDP dissociation inhibitor beta(GDI2)

Item no.	CSB-EP009354HU-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDR NPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVT EGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKF DLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIY GGT
Protein Family	Rab GDI family
Citations	Asada M., Kaibuchi K., Takai Y. The human rab GDI beta gene with long retroposon-rich introns maps to 10p15 and its pseudogene to 7p11-p13.Sedlacek Z., Munstermann E., Mincheva A., Lichter P., Poutska A.Mamm. Genome 9:78-80(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Guanosine diphosphate dissociation inhibitor 2 ;GDI-2
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	66.7 kDa
General Research Areas	Signal Transduction
Relevance	Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th.
Expression Region	1-445aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
Subcellular Location	Cytoplasm, Membrane, Peripheral membrane protein
Tissue Specificity	Ubiquitous.
Gene Names	GDI2
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP009354HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 10/23/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer