« Back
Home /
Recombinant Human Protein BEX3(NGFRAP1)

Recombinant Human Protein BEX3(NGFRAP1)

Manufacturer	Cusabio
Category	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Uterine, Ovarian & Cervical Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP015781HU-50
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Apoptosis
Uniprot ID	Q00994
Gene Names	NGFRAP1
Organism	Homo sapiens (Human)
AA Sequence	MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGN RRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIF MEEMREIRRKLRELQLRNCLRILMGELSNHHDHHD EFCLMP
Expression Region	1-111aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	40 kDa
Alternative Name(s)	Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor
Relevance	May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.
Reference	A comparative gene expression profile of the whole eye from human, mouse, and guinea pig.Zhou X., Wang W., Lu F., Hu S., Jiang L., Yan D., Zhang X., Yu X., Yu J., Qu J.Mol. Vis. 13:2214-2221(2007)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.
Subcellular Location	Nucleus, Cytoplasm
Protein Families	BEX family
Tissue Specificity	Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.
Paythway	Neurotrophinsignalingpathway
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP015781HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time