Comparison

Recombinant Human Proteasome subunit alpha type-1(PSMA1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018865HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
30 kDa prosomal protein ; PROS-30Macropain subunit C2Multicatalytic endopeptidase complex subunit C2; Proteasome component C2; Proteasome nu chain
AA Sequence
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSAT VGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHI GISIAGLTADARLLCNFMRQECLDSRFVFDRPLPV SRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDM GPHIFQTCPSANYFDCRAMSIGARSQSARTYLERH MSEFMECNLNELVKHGLRALRETLPAEQDLTTKNV SIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQ PAQPAD
Research Topic
Immunology
Uniprot ID
P25786
Gene Names
PSMA1
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-251aa
MW of Fusion Proten
32, 2
Sequence Info
Partial
Relevance
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome . Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells .
Reference
"N-terminome analysis of the human mitochondrial proteome."Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M., Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.Proteomics 15:2519-2524(2015)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close