Comparison

Recombinant Human Glycogen phosphorylase, liver form(PYGL),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP019122HU-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P06737
Gene Names
PYGL
Organism
Homo sapiens (Human)
AA Sequence
AKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHL HFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRT QQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQ NACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLA ACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQ VEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTN TGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWS ARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLY PNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASK FGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELM RIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALE RWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPK DVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGV AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRR WLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPS SMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPK KLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVV NNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQ ISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMA EEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEAL PELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDR FKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNI AASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNES NKVNG
Expression Region
2-846aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
123.9 kDa
Relevance
Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Reference
The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Involvement in disease
Glycogen storage disease 6 (GSD6)
Protein Families
Glycogen phosphorylase family
Paythway
Necroptosis
Amount: 50ug
Available: In stock
Listprice: €227.63
Price: €227.63
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close