Comparison

Recombinant Human Ras-related protein Rab-27B(RAB27B)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP019178HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O00194
Gene Names
RAB27B
Organism
Homo sapiens (Human)
AA Sequence
TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNP KFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQ LWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQS FLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQR EVNERQARELADKYGIPYFETSAATGQNVEKAVET LLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKP PEKKCIC
Expression Region
2-218aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
40.5 kDa
Alternative Name
C25KG
Relevance
May be involved in targeting uroplakins to urothelial apical mbranes.
Reference
Molecular cloning and characterization of rab27a and rab27b, novel human rab proteins shared by melanocytes and platelets.Chen D., Guo J., Miki T., Tachibana M., Gahl W.A.Biochem. Mol. Med. 60:27-37(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May be involved in targeting uroplakins to urothelial apical membranes.
Subcellular Location
Membrane, Lipid-anchor
Protein Families
Small GTPase superfamily, Rab family
Tissue Specificity
Expressed primarily in testis.
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close